Loading...
Statistics
Advertisement

q45545.cn
www.q45545.cn/

Q45545.cn

Advertisement
Conversion Technology Metas Server
Q45545.cn is hosted in China / Beijing . Q45545.cn doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Javascript, Php, Number of used javascripts: 2. First javascripts: Caf.js, Parking_caf_281_1409192.js, Number of used analytics tools: 0. Its server type is: Tengine/1.4.2.

Technologies in use by Q45545.cn

Technology

Number of occurences: 3
  • Html
  • Javascript
  • Php

Advertisement

Javascripts

Number of occurences: 2
  • caf.js
  • parking_caf_281_1409192.js

Advertise

Number of occurences: 1
  • Google Adsense

Server Type

  • Tengine/1.4.2

Powered by

  • PHP/5.3.10

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Q45545.cn

Missing HTTPS protocol.

    Meta - Q45545.cn

    Number of occurences: 1
    • Name:
      Content: text/html; charset=utf-8

    Server / Hosting

    • IP: 124.16.31.152
    • Latitude: 39.93
    • Longitude: 116.39
    • Country: China
    • City: Beijing

    Rname

    • ns2.alidns.com
    • ns1.alidns.com

    Target

    • hostmaster.hichina.com

    HTTP Header Response

    HTTP/1.1 200 OK Server: Tengine/1.4.2 Date: Fri, 20 May 2016 16:02:34 GMT Content-Type: text/html;charset=utf-8 Vary: Accept-Encoding X-Powered-By: PHP/5.3.10 Set-Cookie: PHPSESSID=8ujs56k0o4qlif96mfglm61612; path=/ Expires: Thu, 19 Nov 1981 08:52:00 GMT Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Pragma: no-cache X-Cache: MISS from s_bd39 X-Cache-Lookup: MISS from s_bd39:80 Via: 1.1 s_bd39 (squid/3.5.19) Connection: keep-alive

    DNS

    host: q45545.cn
    1. class: IN
    2. ttl: 600
    3. type: A
    4. ip: 124.16.31.152
    host: q45545.cn
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.alidns.com
    host: q45545.cn
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.alidns.com
    host: q45545.cn
    1. class: IN
    2. ttl: 600
    3. type: SOA
    4. mname: ns1.alidns.com
    5. rname: hostmaster.hichina.com
    6. serial: 2015042721
    7. refresh: 3600
    8. retry: 1200
    9. expire: 3600
    10. minimum-ttl: 360

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.45545.cn, www.qe45545.cn, www.e45545.cn, www.qr45545.cn, www.r45545.cn, www.qv45545.cn, www.v45545.cn, www.qb45545.cn, www.b45545.cn, www.qn45545.cn, www.n45545.cn, www.qf45545.cn, www.f45545.cn, www.qg45545.cn, www.g45545.cn, www.qh45545.cn, www.h45545.cn, www.qy45545.cn, www.y45545.cn, www.q5545.cn, www.q4w5545.cn, www.qw5545.cn, www.q4q5545.cn, www.qq5545.cn, www.q4t5545.cn, www.qt5545.cn, www.q4e5545.cn, www.qe5545.cn, www.q4r5545.cn, www.qr5545.cn, www.q425545.cn, www.q25545.cn, www.q4545.cn, www.q45e545.cn, www.q4e545.cn, www.q45r545.cn, www.q4r545.cn, www.q452545.cn, www.q42545.cn, www.q45t545.cn, www.q4t545.cn, www.q453545.cn, www.q43545.cn, www.q4545.cn, www.q455e45.cn, www.q45e45.cn, www.q455r45.cn, www.q45r45.cn, www.q455245.cn, www.q45245.cn, www.q455t45.cn, www.q45t45.cn, www.q455345.cn, www.q45345.cn, www.q4555.cn, www.q4554w5.cn, www.q455w5.cn, www.q4554q5.cn, www.q455q5.cn, www.q4554t5.cn, www.q455t5.cn, www.q4554e5.cn, www.q455e5.cn, www.q4554r5.cn, www.q455r5.cn, www.q455425.cn, www.q45525.cn, www.q4554.cn, www.q45545e.cn, www.q4554e.cn, www.q45545r.cn, www.q4554r.cn, www.q455452.cn, www.q45542.cn, www.q45545t.cn, www.q4554t.cn, www.q455453.cn, www.q45543.cn,

    Other websites we recently analyzed

    1. Home - Canoeing, Kayaking, Cornwall Canoe Trips, Kayak Hire, River Fowey, Cornwall Kayak Holiday
      Encounter Cornwall has been running guided canoe trips and kayak hire on the Fowey Estuary since 2006. Our trips are an ideal introduction to kayaking on the Fowey’s sheltered tidal waters, and are suitable for both families and those new to kayaking.
      United Kingdom - 94.229.166.7
      G Analytics ID: UA-61227501-1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Flexslider, Html, Javascript, jQuery Fancybox, Php, Google Analytics, Facebook Box, Share This Social Media Buttons
      Number of Javascript: 7
      Number of meta tags: 4
    2. Mamasita Bar & Grill
      Best Mexican Food in New York & Hell's Kitchen. Fresh Mexican food in 10019. Gluten free. No MSG, no Animal Fat, and no LARD.
      Scottsdale (United States) - 198.71.232.3
      Server software: DPS/0.2.7
      Technology: CSS, Html, Html5, Javascript
      Number of Javascript: 2
      Number of meta tags: 4
    3. sveltos.com
      Houston (United States) - 192.185.92.110
      Server software: nginx/1.10.0
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 5
    4. Ãœber uns | cairos-academy
      Germany - 78.47.220.105
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 1
    5. miscmannamagalginknimatnyasvetchargapoleaz
      San Francisco (United States) - 192.0.78.13
      Server software: nginx
      Technology: Skimlinks, CSS, Gravatar, Html, Html5, Javascript, Php, Pingback, Shortcodes, comScore, Wordpress, Twitter Button
      Number of Javascript: 8
      Number of meta tags: 7
    6. ¿Ã‹Ã‚¡ÍõվȺ ÁªÏµQQ£º1785605588
      Kansas City (United States) - 173.208.215.148
      Server software: Microsoft-IIS/6.0
      Technology: Html
      Number of meta tags: 1
    7. Restaurant La Ripaille
      Le restaurant La Ripaille est situé à Arromanches, nous vous proposons une cuisine Normande traditionnelle.
      France - 213.186.33.104
      G Analytics ID: UA-441859-8
      Server software: Apache
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, Google Analytics
      Number of Javascript: 2
      Number of meta tags: 4
    8. Tennessee Career Centers
      Columbia (United States) - 66.211.30.3
      G Analytics ID: UA-39861102-1
      Server software:
      Technology: CSS, Html, Iframe, Javascript, Php, Swf Object, Google Analytics, Facebook Like box
      Number of Javascript: 4
      Number of meta tags: 1
    9. Home | Instant Spark
      Scottsdale (United States) - 173.201.243.1
      Server software: Apache
      Technology: Html
    10. Die Potsdam Lions
      Germany - 212.90.148.98
      Server software: Apache/2.2.31
      Technology: Html, Php
      Number of meta tags: 1

    Check Other Websites